PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00792g03002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 405aa    MW: 45683.3 Da    PI: 5.4158
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00792g03002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.44.8e-52321591128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                               l+pGfrFhPtdeelv +yL++k+ +k++++ ++++e+d+yk+ePw+L +  ++k+++ ewyfFs+ d+ky +g+r nrat +gyW
  Niben101Scf00792g03002.1  32 LAPGFRFHPTDEELVRYYLRRKACAKPFRF-QAVSEIDVYKSEPWELAEysSLKTRDLEWYFFSPVDRKYGNGSRLNRATGKGYW 115
                               579*************************99.88**************84346777888*************************** PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               katgkd++v + k++++g+kktLvf++grap+g++t+Wvmheyrl
  Niben101Scf00792g03002.1 116 KATGKDRPVRH-KSQTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 159
                               ***********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6225182IPR003441NAC domain
PROSITE profilePS5100557.92832182IPR003441NAC domain
PfamPF023653.8E-2834159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MEQEGALVIV PAAVPVTTAT PKRAVAPPPT SLAPGFRFHP TDEELVRYYL RRKACAKPFR  60
FQAVSEIDVY KSEPWELAEY SSLKTRDLEW YFFSPVDRKY GNGSRLNRAT GKGYWKATGK  120
DRPVRHKSQT IGMKKTLVFH SGRAPDGKRT NWVMHEYRLT DEELERAGVV QDAFVLCRIF  180
QKSGLGPPNG DRYAPFIEEE WDDDTALLVP GGETEDDVAN GDEARVEGND LDQDARHKAP  240
SRQSQNLLEP QPIPFICKRE RSPEDPEPLS LAQSKRSKRE DPSSSHANGS EDSTTSQQDP  300
PTTMMTTNYS PPSLLAFPLL EPLEPKESQP SNPPTFDSSN LEKSVPPGYL KFISNLENEI  360
LNVSMERETL KIEVMRAQAM INILQSRIDL LNKENEDLRR LVRGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-513118216165NO APICAL MERISTEM PROTEIN
1ut4_B3e-513118216165NO APICAL MERISTEM PROTEIN
1ut7_A3e-513118216165NO APICAL MERISTEM PROTEIN
1ut7_B3e-513118216165NO APICAL MERISTEM PROTEIN
4dul_A3e-513118216165NAC domain-containing protein 19
4dul_B3e-513118216165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780872.10.0PREDICTED: NAC domain-containing protein 78-like
RefseqXP_016454404.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLQ8LRM10.0Q8LRM1_PETHY; Nam-like protein 4
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.12e-96NAC domain containing protein 52